PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10006679
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family LBD
Protein Properties Length: 281aa    MW: 31445.1 Da    PI: 6.2137
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10006679genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260127.27.6e-4071061100
       DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98 
                  +CaaCk++rrkC+++C++ap+fp +qp+kfa +hk+FGasnv k+l++lp   re+a+ sl yeA ar+rdPvyG+v+ i++lq++l+ql+ e+++ k
  Lus10006679   7 PCAACKLQRRKCTQECIFAPHFPPDQPQKFADIHKVFGASNVAKMLSELPAMSREEAVISLSYEAGARIRDPVYGCVSAISELQHRLKQLHMEIDAGK 104
                  7********************************************************************************************99888 PP

       DUF260  99 ee 100
                  +e
  Lus10006679 105 QE 106
                  76 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.0486107IPR004883Lateral organ boundaries, LOB
PfamPF031956.9E-407102IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 281 aa     Download sequence    Send to blast
MSHSQQPCAA CKLQRRKCTQ ECIFAPHFPP DQPQKFADIH KVFGASNVAK MLSELPAMSR  60
EEAVISLSYE AGARIRDPVY GCVSAISELQ HRLKQLHMEI DAGKQELLKY MGSNNQQNPA  120
LMIPNSTTAG FNIAPALHHQ NQQQNMMMQM IEGGHQMLDA QLMAAEMQHQ HQEMFKVHEQ  180
SEQQQQHNHN HNHNHNNYGM LDDQVVDSVA ANGFNQIGGA EFEPSLALGS MVNHEQSQVE  240
IPAHHEQLFF QLEHHEPELS HYHHQSSGSD EGANSSLALS *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A0B0PS922e-58A0A0B0PS92_G
STRINGVIT_07s0197g00030.t011e-54(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66870.11e-51ASYMMETRIC LEAVES 2-like 1